PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC026665.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 128aa    MW: 14575.8 Da    PI: 11.1035
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC026665.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.2e-27252556
       G2-like  5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                  +WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  EcC026665.10  2 DWTPELHRRFVQAVEQL-GLDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 52
                  7****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.779154IPR017930Myb domain
TIGRFAMsTIGR015572.2E-26152IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.1E-26255IPR009057Homeodomain-like
SuperFamilySSF466891.61E-18255IPR009057Homeodomain-like
PfamPF002491.2E-8250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
VDWTPELHRR FVQAVEQLGL DKAVPSRILE LMGIDCLTRH NIASHLQKYR SHRKHMLARE  60
AEAANWSQRR HTHGNGGHKM RPDTMLVMSH STTPTNGSPW LAPATLGFPP VTPMPPHFRP  120
LHVWGHPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16150857ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052247.14e-88PREDICTED: transcription activator GLK1-like
SwissprotQ9SIV33e-47GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A059DGJ04e-88A0A059DGJ0_EUCGR; Uncharacterized protein
STRINGGLYMA06G44330.17e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-48GBF's pro-rich region-interacting factor 1